Protein Info for IAI47_21585 in Pantoea sp. MT58

Annotation: haloacid dehalogenase type II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF00702: Hydrolase" amino acids 13 to 193 (181 residues), 63 bits, see alignment E=7.9e-21 TIGR01428: haloacid dehalogenase, type II" amino acids 14 to 204 (191 residues), 170.8 bits, see alignment E=3.6e-54 TIGR01493: HAD hydrolase, family IA, variant 2" amino acids 14 to 191 (178 residues), 66.1 bits, see alignment E=4.5e-22 PF13419: HAD_2" amino acids 16 to 199 (184 residues), 53.4 bits, see alignment E=5.4e-18 PF13242: Hydrolase_like" amino acids 156 to 221 (66 residues), 23 bits, see alignment E=9.2e-09

Best Hits

KEGG orthology group: K01560, 2-haloacid dehalogenase [EC: 3.8.1.2] (inferred from 89% identity to pva:Pvag_pPag10064)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.8.1.2

Use Curated BLAST to search for 3.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>IAI47_21585 haloacid dehalogenase type II (Pantoea sp. MT58)
MTDSHNPAPYSGTLFFDVNETLLDTTELNRVVAQRLGDRPERAEAWFTSLLHHSLVESVT
GSWHNFGDIAEAVLQMTATRYGITLPADATPLADIIAAMPAHPDVAAGLSALQQQGFTLV
ALTNSSAALAEKQLSSAGLARLFTRILSVEQVQVYKPDLKVYQWAMQEMDQPASQCMMVA
AHGWDVGGAKRAGMKTAFVTRKGQALYPLAPAPDLIVSDIGALATKLKPLC