Protein Info for IAI47_21575 in Pantoea sp. MT58

Annotation: sigma-54-dependent Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 PF14532: Sigma54_activ_2" amino acids 12 to 177 (166 residues), 75 bits, see alignment E=2.1e-24 PF00158: Sigma54_activat" amino acids 13 to 172 (160 residues), 228.4 bits, see alignment E=1.3e-71 PF00004: AAA" amino acids 30 to 148 (119 residues), 21.9 bits, see alignment E=6e-08 PF07728: AAA_5" amino acids 30 to 148 (119 residues), 39.6 bits, see alignment E=1.6e-13 PF02954: HTH_8" amino acids 287 to 314 (28 residues), 27.6 bits, see alignment (E = 5.9e-10) TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 347 to 627 (281 residues), 166.8 bits, see alignment E=3.2e-53 PF09084: NMT1" amino acids 372 to 563 (192 residues), 34.9 bits, see alignment E=4.7e-12

Best Hits

KEGG orthology group: None (inferred from 92% identity to pva:Pvag_pPag10059)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (629 amino acids)

>IAI47_21575 sigma-54-dependent Fis family transcriptional regulator (Pantoea sp. MT58)
MQISSPELIDPASRAFKSVLDQLAPTDATVLIIGETGTGKEVMARYLHHHSARSRQPFLA
VNCGALTESLAESELFGHEKGAFTGAQDRHRGWFEAAEGGTLLLDEVGELSPSLQVKLLR
VLQEREIIRVGSSKAIKVNVRVIAATNRDLAVAIRERWFREDLYYRLNVASVTLPPLRQR
CEDIPVLASHFLQLYARRLGRPQLRLSEDAVATLMDYSWPGNIRELENTLHNAVLLSRTS
LVTPQQLRLNAIAGSDLPSGEEALDQFLRQQMQQSETPLYPRVIAALVKNALELTQGNQL
QAAALLGISRHTLRTQLGHLGVIKPRRTSLRQREASPHHQPQQERELRIGYQKFGNLGIL
KARQSLEQQLSDQGVSVLWSEFPAGPQLLHALNNKEVDFGTTGEVPPLFAQASNSPMVYV
AWEPAAPQSVALLVPTNSPVQQIGDLRGKRIAVNRGSNVHYLLLQILDEAGLALDEVRIV
YAPPKYPLTPSDLNAVDAWMMWDPLLSDAENSGQFRVIADGTGRVNNHQFYLAERGFAAQ
SGDLLQILLTALEQTGRYIDAHHTEAAALLSSELGISATSLMHALARRSHQTQRMNLAII
REQQTIADRFYALGLFSRAIRVRESVWHP