Protein Info for IAI47_21535 in Pantoea sp. MT58

Annotation: Fe(2+) transporter permease subunit FeoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 775 transmembrane" amino acids 279 to 301 (23 residues), see Phobius details amino acids 310 to 337 (28 residues), see Phobius details amino acids 339 to 364 (26 residues), see Phobius details amino acids 390 to 406 (17 residues), see Phobius details amino acids 418 to 444 (27 residues), see Phobius details amino acids 450 to 470 (21 residues), see Phobius details amino acids 508 to 531 (24 residues), see Phobius details amino acids 661 to 682 (22 residues), see Phobius details amino acids 691 to 712 (22 residues), see Phobius details amino acids 718 to 739 (22 residues), see Phobius details PF01926: MMR_HSR1" amino acids 5 to 120 (116 residues), 70.7 bits, see alignment E=3.3e-23 PF02421: FeoB_N" amino acids 5 to 161 (157 residues), 194.7 bits, see alignment E=2.2e-61 TIGR00437: ferrous iron transport protein B" amino acids 10 to 684 (675 residues), 677.2 bits, see alignment E=1.2e-207 PF17910: FeoB_Cyto" amino acids 177 to 256 (80 residues), 33.2 bits, see alignment E=1.8e-11 PF07670: Gate" amino acids 348 to 442 (95 residues), 84.3 bits, see alignment E=2.2e-27 amino acids 509 to 687 (179 residues), 62 bits, see alignment E=2e-20 PF07664: FeoB_C" amino acids 452 to 504 (53 residues), 78.4 bits, see alignment 7.9e-26

Best Hits

Swiss-Prot: 63% identical to FEOB_ECO57: Fe(2+) transporter FeoB (feoB) from Escherichia coli O157:H7

KEGG orthology group: K04759, ferrous iron transport protein B (inferred from 88% identity to pva:Pvag_pPag10044)

MetaCyc: 63% identical to Fe2+ transporter FeoB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-424

Predicted SEED Role

"Ferrous iron transport protein B" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (775 amino acids)

>IAI47_21535 Fe(2+) transporter permease subunit FeoB (Pantoea sp. MT58)
MKKITIGLIGNPNTGKTTLFNQLTGARQQVGNWAGVTVERKEGQFFTAQSDVRLIDLPGT
RSLTTLSAESAIDESIACQYLYQDHADMVINVVDASSLESNLFLTLQLLELGVPCIIALN
MQDVAASQNITTDIQALSARLGCPVVSVTSTRGDGIAQLKTLIDQAHVYCAPERVRYPAA
INSAIEQLCLQMPETIAPQKRYWLALQLLEGDINSQKLCPELLPHLPEMMKQAGNDTGVQ
IADYRYRAINALCAAVSNIHQVLPAGRTRQIDSIVLNRWLGIPIFLAVMYVMFVLSINIG
AALQPLFDSGSVAIFIHGMQWLGYVGHFPDWLTVFLAQGIGSGINTVLPIIPQIGLMFLF
LSFLEDSGYMARAAFVIDRLMQSLGLPGKSFVPLIVGFGCNVPSVMGTRTLDTPRERLLT
VLIAPFMSCGARLAIFAVFAAAFFDAHSSSLVFSLYLLGIVVAIITGLVLRHTLLSGEAS
PFIMEMPVYHRPHLKSLLLQTWQRLKMFVVRAGQVIILVSMLVGVLSSFAFNGQLVEDIN
HSALAASSKAITPALLPIGITQDNWQATVGLVSGIMAKEVVVGTLNSLYTTEALQNNAFD
PQTFNLKAELTDALTQTWAGLTAALRIDALAHPIDASKGDGEMASGSMGIMSAKFGSGFA
AYSYLIFVLLYVPCVSVMGAIAREAGRKWMMFSFFWGLNIAYTTATLFYQTVTFTEHPAF
SATCLIGILLLNMVILFALRKAGSRVQAIPGMMQEGKGRCHGCHGSCDKQKGYAQ