Protein Info for IAI47_21365 in Pantoea sp. MT58

Annotation: Hsp20 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF00011: HSP20" amino acids 48 to 151 (104 residues), 54.9 bits, see alignment E=4.3e-19

Best Hits

Swiss-Prot: 42% identical to IBP_BUCAI: Small heat shock protein ibp (ibp) from Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)

KEGG orthology group: K04080, molecular chaperone IbpA (inferred from 83% identity to pva:Pvag_pPag10007)

Predicted SEED Role

"Small heat shock protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>IAI47_21365 Hsp20 family protein (Pantoea sp. MT58)
MSVQHVSVFPSLSDSVFSDRFNRIDKLFSQLTGDSPVSSVPAYDLKHVEENRYALTVSVP
GWKEHELEIELRGDRLSVAGHREQASQHASDEAGKESGRWIHRGISRHDFQLSFSIPEHI
KVTEASLAEGLLNIDLLQEIPESEKPRRIPIAIGGQRTLEHQ