Protein Info for IAI47_21295 in Pantoea sp. MT58

Annotation: DJ-1/PfpI family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01965: DJ-1_PfpI
  • amino acids 8 to 166 (159 residues), 100.8 bits, E=3.8e-33

Best Hits

Swiss-Prot: 60% identical to INHA_PSEPU: Isonitrile hydratase (inhA) from Pseudomonas putida

KEGG orthology group: None (inferred from 85% identity to pva:Pvag_pPag30009)

MetaCyc: 60% identical to isocyanide hydratase subunit (Pseudomonas putida N19-2)
Cyclohexyl-isocyanide hydratase. [EC: 4.2.1.103]

Predicted SEED Role

"ThiJ/PfpI family protein"

KEGG Metabolic Maps

• Caprolactam degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.103

Protein Sequence (239 amino acids)

>IAI47_21295 DJ-1/PfpI family protein (Pantoea sp. MT58)
MNRPLQIGLLLFPDVTQLDLTGPWEVFARTPDTRCHLVWKDLQPVRSDRGLSILPTMTFD
TCPQLDVICVPGGPGQIALMSDNVTLNFLQKQATQAQWITSVCTGSLVLGAAGLLKGYRA
TSHWSSIDQLALLGADPVSQRVVRDRNRISGAGVTSGIDFALTLVAEIAGDAVAKAVQLQ
MEYDPQPPFTSGSPKTAPPQEVEQAKAKMAAFIATRRAATMRAAQRLQAEQLPDAGNTQ