Protein Info for IAI47_21275 in Pantoea sp. MT58

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 20 to 48 (29 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 204 to 228 (25 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 21 to 127 (107 residues), 53.6 bits, see alignment E=1.3e-18 PF00528: BPD_transp_1" amino acids 47 to 230 (184 residues), 74.6 bits, see alignment E=4.4e-25

Best Hits

Swiss-Prot: 48% identical to OCCQ_AGRT4: Octopine transport system permease protein OccQ (occQ) from Agrobacterium tumefaciens (strain Ach5)

KEGG orthology group: K10020, octopine/nopaline transport system permease protein (inferred from 98% identity to pva:Pvag_pPag30022)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>IAI47_21275 ABC transporter permease subunit (Pantoea sp. MT58)
MLMNIDWQILGFGDEGWGGVLLSAAAVTVSVSLCAWLLGAMLGSVLCWMQIAGSRWQQRL
AAGYITLFRGVPELLVIYLFYFGGRQVVSTVGTALGFQGPFDVNGFVAGAIAIGLISGAY
QSGVFRGAFYAIPGGTLEAATVTGMGRLMMFRRIIVPQALRTALPGMGNQWQSVIKESAL
VSVTGLVETMNQVSTAANSTQMSFFFYSVGAVIYLIITTCSDMVFRYVEKFAMRGQQRVK
G