Protein Info for IAI47_21270 in Pantoea sp. MT58

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 93 to 109 (17 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 114 (103 residues), 66.1 bits, see alignment E=1.6e-22 PF00528: BPD_transp_1" amino acids 32 to 220 (189 residues), 67.1 bits, see alignment E=8.9e-23

Best Hits

Swiss-Prot: 50% identical to OCCM_RHIML: Octopine transport system permease protein OccM (occM) from Rhizobium meliloti

KEGG orthology group: K10019, octopine/nopaline transport system permease protein (inferred from 98% identity to pva:Pvag_pPag30023)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>IAI47_21270 ABC transporter permease subunit (Pantoea sp. MT58)
MDIMFLHQTLLALLKGLPLTINLALLSLLGGGVLALLLNLLRMTRTGSFFCRFYVWLFRG
TPLLIQIFMVYYGLGSLPAVRDSLFWPLLRDPYWCGLLALILNDAAYTSEILRGGLRAVS
QQSLEAAKVSGMSSYKIFTRITLPIAIRQALPAYSNEIISMIKATSLVSTISLMEMTGIA
DSIVSSTFRALEVFLSAAVIYLILTMLVSKGVSMLERRLSPYYFGARS