Protein Info for IAI47_21125 in Pantoea sp. MT58
Annotation: metalloregulator ArsR/SmtB family transcription factor
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to ARSR1_ECOLX: Arsenical resistance operon repressor (arsR) from Escherichia coli
KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 87% identity to pam:PANA_1896)MetaCyc: 57% identical to DNA-binding transcriptional repressor ArsR (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Arsenical resistance operon repressor" in subsystem Arsenic resistance
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (117 amino acids)
>IAI47_21125 metalloregulator ArsR/SmtB family transcription factor (Pantoea sp. MT58) MPQLSPLQLFKGLSDETRLNLVLLLREKGELCVCELTLILKESQPKISRHLALLRDTGLL IDRREGKWIHYRLSPHMPAWAAAVIEQAYLCQRDDILDLSKQAERDNVTTNGKSVCI