Protein Info for IAI47_21115 in Pantoea sp. MT58

Annotation: arsenate reductase (glutaredoxin)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00014: arsenate reductase (glutaredoxin)
  • amino acids 4 to 116 (113 residues), 144 bits, E=1.3e-46
• PF03960: ArsC
  • amino acids 7 to 114 (108 residues), 84.1 bits, E=3.2e-28

Best Hits

Swiss-Prot: 81% identical to ARSC2_ECOLX: Arsenate reductase (arsC) from Escherichia coli

KEGG orthology group: K00537, arsenate reductase [EC: 1.20.4.1] (inferred from 90% identity to bta:100336527)

MetaCyc: 81% identical to arsenate reductase (Escherichia coli K-12 substr. MG1655)
Arsenate reductase (glutaredoxin). [EC: 1.20.4.1]

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

• arsenate detoxification III (2/2 steps found)
• arsenic detoxification (bacteria) (3/4 steps found)
• arsenate detoxification I (4/6 steps found)
• arsenic detoxification (plants) (4/6 steps found)
• arsenic detoxification (yeast) (4/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Protein Sequence (133 amino acids)

>IAI47_21115 arsenate reductase (glutaredoxin) (Pantoea sp. MT58)
MTDITIYHNPACGTSRNTLAFIRNSGVEPLVILYLETPPTRDELQKLIADMGISVRELLR
KNTEPYEQLGLAEDKFSDDELLDAMLAHPVLINRPVVVTPLGTKLCRPSEVVLEILPDPQ
QGPFTKEEGGSNQ