Protein Info for IAI47_20875 in Pantoea sp. MT58

Annotation: glutathione peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00255: GSHPx
  • amino acids 4 to 111 (108 residues), 141 bits, E=5.3e-46

Best Hits

Swiss-Prot: 60% identical to GPO_LACLA: Glutathione peroxidase (gpo) from Lactococcus lactis subsp. lactis (strain IL1403)

KEGG orthology group: K00432, glutathione peroxidase [EC: 1.11.1.9] (inferred from 85% identity to pva:Pvag_pPag30130)

MetaCyc: 53% identical to hydroperoxy fatty acid reductase 1 (Synechocystis sp. PCC 6803)
RXN-13944 [EC: 1.11.1.22]; 1.11.1.- [EC: 1.11.1.22]

Predicted SEED Role

"Glutathione peroxidase family protein"

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• glutathione-peroxide redox reactions (2/3 steps found)

KEGG Metabolic Maps

• Arachidonic acid metabolism
• Glutathione metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.9

Use Curated BLAST to search for 1.11.1.22 or 1.11.1.9

Protein Sequence (158 amino acids)

>IAI47_20875 glutathione peroxidase (Pantoea sp. MT58)
MSPFYQFKAASLNGELISMNDFAGNVVLVVNTASHCGFTPQYAGLEDLYKKYAAQGLVVL
GFPCNQFGKQEPGGADEIAQTCHINYGASFPMFGKVEVNGAAAHPIFRYLKEELPGVLGG
RIKWNFTKFLIGRDGKPIKRFAPTTTPGKMEAAIIAAL