Protein Info for IAI47_20845 in Pantoea sp. MT58

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00106: adh_short" amino acids 8 to 209 (202 residues), 196 bits, see alignment E=7.3e-62 PF08659: KR" amino acids 10 to 181 (172 residues), 57.4 bits, see alignment E=2.8e-19 PF13561: adh_short_C2" amino acids 14 to 257 (244 residues), 217.7 bits, see alignment E=2.7e-68

Best Hits

Swiss-Prot: 40% identical to FABG_STAAC: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Staphylococcus aureus (strain COL)

KEGG orthology group: None (inferred from 92% identity to pva:Pvag_pPag30134)

Predicted SEED Role

"Glucose 1-dehydrogenase (EC 1.1.1.47)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 1.1.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>IAI47_20845 SDR family oxidoreductase (Pantoea sp. MT58)
MIFSLKNQVALVTGASSGLGYACAEALAREGACVVVNYHSQAEPAEKLVENIRADGGRAI
AVKGDVSKEAEVQNLFDQTIAEFGRLDILVANSGLQKDAPSIEMTLEDWNTVINVNLTGQ
FLCARAALRQFRSQEHRPHLSRAVGKIIHMSSVHQLIPWAGHVNYAASKGGVDLLMKSLA
QEVGEDRIRVNSVAPGAIATAINEEATQGEAGKELLKLIPYGRIGAAEDVANAVVWLASD
LSDYVHGTTLFIDGGMSLYPGFRDNG