Protein Info for IAI47_20780 in Pantoea sp. MT58

Annotation: cupin domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07883: Cupin_2
  • amino acids 32 to 99 (68 residues), 59.1 bits, E=1.4e-20

Best Hits

KEGG orthology group: None (inferred from 79% identity to pva:Pvag_pPag10019)

Predicted SEED Role

"Mannose-6-phosphate isomerase (EC 5.3.1.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.3.1.8)

MetaCyc Pathways

• D-mannose degradation I (2/2 steps found)
• D-mannose degradation II (2/2 steps found)
• mannitol degradation II (3/4 steps found)
• mannitol biosynthesis (2/3 steps found)
• 1,5-anhydrofructose degradation (3/5 steps found)
• GDP-mannose biosynthesis (2/4 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (1/3 steps found)
• colanic acid building blocks biosynthesis (6/11 steps found)
• β-(1,4)-mannan degradation (1/7 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (4/14 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.8

Use Curated BLAST to search for 5.3.1.8

Protein Sequence (115 amino acids)

>IAI47_20780 cupin domain-containing protein (Pantoea sp. MT58)
MISKENAEHYVWGEECDGWYLLNRQDMLVIHEKMPQGTSEKRHWHAVSRQFFFVLSGVLT
MESEGEKHDIKAQQGLEIPPGAKHQARNDTGFPVEFLVISHPSTRGDRADLPENG