Protein Info for IAI47_20625 in Pantoea sp. MT58

Annotation: DUF2946 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details amino acids 29 to 30 (2 residues), see Phobius details transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 75 to 98 (24 residues), see Phobius details PF11162: DUF2946" amino acids 14 to 126 (113 residues), 63.4 bits, see alignment E=1.6e-21

Best Hits

KEGG orthology group: None (inferred from 69% identity to pam:PANA_4155)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>IAI47_20625 DUF2946 domain-containing protein (Pantoea sp. MT58)
MQRSDIRQRLTAGIAILAVLLLFVAPMISKNLAEHRAMMQDASAMSAEMPMMDHHSEMAM
ADHGMMMGSGFACGYCDLLVHVPLMLWVFIPFIWWMCLISRAPPPSAINPPQWRRLLRLH
RPRAPPCFASHRLLTDSIA