Protein Info for IAI47_20530 in Pantoea sp. MT58

Annotation: maltose ABC transporter permease MalF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 274 to 300 (27 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details amino acids 407 to 430 (24 residues), see Phobius details amino acids 479 to 500 (22 residues), see Phobius details PF20872: MalF_N_TM" amino acids 12 to 58 (47 residues), 68.7 bits, see alignment 4.1e-23 PF14785: MalF_P2" amino acids 97 to 254 (158 residues), 179 bits, see alignment E=1.1e-56 PF00528: BPD_transp_1" amino acids 292 to 496 (205 residues), 69.7 bits, see alignment E=4.3e-23

Best Hits

Swiss-Prot: 79% identical to MALF_ECOL6: Maltose/maltodextrin transport system permease protein MalF (malF) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K10109, maltose/maltodextrin transport system permease protein (inferred from 95% identity to pva:Pvag_pPag30207)

MetaCyc: 79% identical to maltose ABC transporter membrane subunit MalF (Escherichia coli K-12 substr. MG1655)
ABC-16-RXN [EC: 7.5.2.1]; 7.5.2.1 [EC: 7.5.2.1]; 7.5.2.1 [EC: 7.5.2.1]

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (508 amino acids)

>IAI47_20530 maltose ABC transporter permease MalF (Pantoea sp. MT58)
MSGKPKTHSLLLKGVLIGIGCLLVGYLLILMYAQGEYLFALLTLILSATGLWIFANRRAY
AWRYVYPGVAGMSLFVLFPLACTIAIAFTNYSSTNQLTFERAQQVLLGRTFQSGEAVSFS
LFPAGDRWQLVLKDGKADFVSPPFQFGAEQTLKMMPATPPAGERATFRVITTNRQALSQI
RAELPDGRQLRMSSLRQFSGTQPLYRVGAKDELINQQSGTHYRANPQTGFYQAVNADNKW
GNETLSPGFTVNTGWKNFVRVFTDEGIQKPFLAIFGWTLLFSLITVVLTVAVGMVLACLV
QWEALRGKAIYRVMLILPYAVPAFISILIFKGLFNQSFGEINVMLSALFGVKPAWFSDPT
LARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPLQNFFLITLPLLLKPL
MPLMIASFAFNFNNFVLVQLLTNGGPDRLGTTTPAGYTDLLVNYTWRIAFEGGGGQDFGL
AAAIATLIFLLVGALAVINLKASRMKFD