Protein Info for IAI47_20515 in Pantoea sp. MT58

Annotation: maltoporin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02264: LamB
  • amino acids 27 to 433 (407 residues), 441.9 bits, E=1.9e-136

Best Hits

Swiss-Prot: 78% identical to LAMB_SALA4: Maltoporin (lamB) from Salmonella agona (strain SL483)

KEGG orthology group: K02024, maltoporin (inferred from 96% identity to pva:Pvag_pPag30210)

MetaCyc: 77% identical to maltose outer membrane channel / phage lambda receptor protein (Escherichia coli K-12 substr. MG1655)
RXN0-1741; RXN0-1804

Predicted SEED Role

"Maltoporin (maltose/maltodextrin high-affinity receptor, phage lambda receptor protein)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Uptake and Utilization

Protein Sequence (433 amino acids)

>IAI47_20515 maltoporin (Pantoea sp. MT58)
MLTLRKLPIAVAVAVGTLSAPTMAVDFTGYARSGIGWTGSGGEQQCFQATGAQSKYRLGN
ECETYAELKLGQEVWKEGDKSFYFDTNVAYSVAQQNDWEATSPAFREANVKGKNLIDSLP
GSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGLEDVDLGFGKLSFAATRSSEAGGSYTFS
SDRIRDFATSTANDVFDVRLAGLETNPNGVLELGVDYGRANARDGYRIEDGASKDGWMFT
AEHTQSMLKGYNKFVLQYATDAMTSQGKGVPQGTNLNNNGKMYRVLDHGAISLAERWDLM
YVAMYQNIDLDNNRGTDWYTVGVRPMYKWTPIMSTLLELGYDNVKSQQANERNGQYKVTL
AQQWQAGDSIWSRPALRLFATYAKWDEKWGYNKDASGDLTSFASTDSTGNGILTNSRGKD
DEVTFGAQMEIWW