Protein Info for IAI47_20500 in Pantoea sp. MT58

Annotation: type II toxin-antitoxin system YhaV family toxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF11663: Toxin_YhaV" amino acids 12 to 148 (137 residues), 178.5 bits, see alignment E=3.4e-57

Best Hits

Swiss-Prot: 53% identical to YHAV_ECO57: Toxin YhaV (yhaV) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 55% identity to plu:plu3944)

MetaCyc: 53% identical to ribosome-dependent mRNA interferase toxin YhaV (Escherichia coli K-12 substr. MG1655)
Physarum polycephalum ribonuclease. [EC: 3.1.26.1]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>IAI47_20500 type II toxin-antitoxin system YhaV family toxin (Pantoea sp. MT58)
MEDGTVMNGWHVYVHPCFESQLIALTNEVESLRAKYPESYQRIATTKLLAAVFKVINSEI
CADSHHAKFRQGDTLGEQNKHWFRAKFLMQYRLFFRFSEQHKTIILAWMNDAETKRAYGS
KRDAYKVFSGMLHNGYPPDDWALLLKQSQDWDNTNS