Protein Info for IAI47_20410 in Pantoea sp. MT58

Annotation: two-component system sensor histidine kinase DcuS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details PF17203: sCache_3_2" amino acids 49 to 180 (132 residues), 71 bits, see alignment E=3e-23 PF00989: PAS" amino acids 223 to 324 (102 residues), 29.6 bits, see alignment E=1.5e-10 PF14689: SPOB_a" amino acids 340 to 385 (46 residues), 35.7 bits, see alignment 1.3e-12 PF02518: HATPase_c" amino acids 436 to 537 (102 residues), 65.7 bits, see alignment E=1.2e-21 PF14501: HATPase_c_5" amino acids 436 to 530 (95 residues), 36.4 bits, see alignment E=1.1e-12

Best Hits

KEGG orthology group: K07701, two-component system, CitB family, sensor histidine kinase DcuS [EC: 2.7.13.3] (inferred from 96% identity to pva:Pvag_pPag30234)

Predicted SEED Role

"Fumarate respiration sensor kinase protein DcuS"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (544 amino acids)

>IAI47_20410 two-component system sensor histidine kinase DcuS (Pantoea sp. MT58)
MKSQTQNRYAVPKRPMKLSTLTTLMMTAVIITVLVAVHVLYFVQIDNFAQSHLKDKAMAV
ARTLADTPEVQRGLLLPDGSSQIQPLAEAARKRNGLLFVVVTDMQGIRFSHPNAAVIGKH
FVGNDIYPTLDGRENVAVNHGVLVEALRVFTPVYNAQHQQIGVVAIGIALNDVAAQIAKS
RWNIVWTVLFGGLAGLLGMLILVRRLKTILLGLEPHEISSLFEQRQAILNSIKEGVIAVD
DQSRVSLINHAAQQLLHETTRKMPSSGDLIAEESVMHRHQQDALHAGKAWYDQELTLGNR
ILISNTVPVRSRDRIIGAVTTFRDKTEISQLMQRLDGMVNYVDALRERSHEFMNKLHVIL
GLLHMKNYAQMEEYILKTANAYQTEIGSLLQKIKSPIIAGFLLSKINRVTDEGHQLIIDE
ASFLPDCGSEEQNAVLITVLGNLIENSLEALDPETEGEIHLMLHYQNGWLACEVSDDGPG
IDGNQLSTIFERGVSSKGDDRGVGLFLVKQQTESLGGNVSVESEPGVFTQFLVQLPWERG
MITQ