Protein Info for IAI47_20365 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 169 to 192 (24 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 249 to 267 (19 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 246 (226 residues), 121.1 bits, see alignment E=5.4e-39 amino acids 232 to 390 (159 residues), 40.6 bits, see alignment E=1.5e-14 PF00083: Sugar_tr" amino acids 49 to 186 (138 residues), 41.6 bits, see alignment E=7.9e-15

Best Hits

KEGG orthology group: K08156, MFS transporter, DHA1 family, arabinose polymer transporter (inferred from 97% identity to pva:Pvag_pPag30247)

Predicted SEED Role

"putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>IAI47_20365 MFS transporter (Pantoea sp. MT58)
MLRKNHKTDDAGFVRWALLALALGGFGIGTGEFIMMGLLPDVSRSLEITEPQAGNAIASY
ALGVVVGAPFIAVLAARMARKSLLLILMALFSIGNVASAMADSYHGLLVARFLTGLPHGA
YFGVASLVAASLVPIERRGRALASLMLGLTVATLIGVPLGSWIGQLFSWHVVFTFVGAIG
LLTCLLIGRYVPYVAGDADAHPLRELGALKNPQVLLTLLVGAVGFGGMFAIFSYIAPTLI
NIAGISPSLIPWAMVAFGLGMIIGNLVGGRLADGSVLNIIGWTLLWNVLVMLAFPVLVQH
VATGLLATFLIGTCSVLLPSLQIRLMDVANDSQTLAAAMNHSALNIANAMGAYLGGLTVS
LGYGWISTAWVGVALGVAGLMVFVMTARHAARQQTQLA