Protein Info for IAI47_20240 in Pantoea sp. MT58

Annotation: sigma-70 family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 25 to 176 (152 residues), 68 bits, see alignment E=3.9e-23 PF04542: Sigma70_r2" amino acids 31 to 97 (67 residues), 36 bits, see alignment E=7.5e-13 PF08281: Sigma70_r4_2" amino acids 126 to 172 (47 residues), 32.1 bits, see alignment E=1.1e-11 PF04545: Sigma70_r4" amino acids 127 to 175 (49 residues), 34.2 bits, see alignment E=2.2e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 91% identity to pva:Pvag_pPag30274)

Predicted SEED Role

"RNA polymerase, sigma-24 subunit, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>IAI47_20240 sigma-70 family RNA polymerase sigma factor (Pantoea sp. MT58)
MSETDPRAQQWPALMARAQAGDRAAYNQLLKAMVPAIRALVCKKIRDEVLVEDVIQETLL
AIHRVRHTYDPQRPILPWVAAIASARTIDTLRQHGRRQEVQDEEALQKRPAESSELQSDN
DILSGYLDILPLRQREIVESVHLREQSLAQAAAETHQSLSAVKSLLHRAMVNLRKYGRGV
HEKS