Protein Info for IAI47_20230 in Pantoea sp. MT58

Annotation: peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF08534: Redoxin" amino acids 30 to 169 (140 residues), 74.1 bits, see alignment E=1.1e-24 PF00578: AhpC-TSA" amino acids 31 to 158 (128 residues), 94.1 bits, see alignment E=6.4e-31

Best Hits

KEGG orthology group: None (inferred from 98% identity to pva:Pvag_pPag30276)

Predicted SEED Role

"Alkyl hydroperoxide reductase subunit C-like protein" in subsystem Oxidative stress or Rubrerythrin or Thioredoxin-disulfide reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>IAI47_20230 peroxiredoxin (Pantoea sp. MT58)
MPMKNTLKTLAVATLLALSVPATSAFAALQVGEKAPDFKLDAALAGKSTTFSLQQALKKG
PVVLYFFPAAFSAGCTLEAHDFAEASDEFKKQGATVIGVTAGNTDQIAKFSQLECRDKFT
VAADPGAKVAAEYKSTMEMKGQKLSDRTSYVIAPDGKILLSFTDKNPDTHIQKAMDAVKK
YRQANPA