Protein Info for IAI47_20215 in Pantoea sp. MT58

Annotation: helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 47 (15 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details PF12833: HTH_18" amino acids 254 to 333 (80 residues), 65 bits, see alignment E=3.3e-22

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>IAI47_20215 helix-turn-helix transcriptional regulator (Pantoea sp. MT58)
MLSVPFPVITLLALFLLMATVFSGKPCNNGALRFLSACIILVSLNTIRWEYDSHFLRDLQ
SVMAMLLPAIAWHSFVPLNDNKRKHDLFVMIVPVLVSLAIRLVWAPATDFILSLLFFSYG
VGLLKKAFVNEQKLKFNRLKEIPQQASLTFFAGSFLCLSALTDLLIAIDFDISGGKHAAL
IILITQLLLLPIVGVIIYNFINSHQQFEPDIRQEKDTTDEKAPAADMTELYIVLEKKIHE
SELYLDPNLTLALLARKTGVPARNFSAAVNSVKQCNVSQWINGFRVERAKELLLSTSLPV
THIMLESGFMTKSNFNREFQRLSGLSPRLFRQQALDNSVQNSEKL