Protein Info for IAI47_20170 in Pantoea sp. MT58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 81 to 103 (23 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 174 to 187 (14 residues), see Phobius details amino acids 200 to 225 (26 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 260 (168 residues), 72.2 bits, see alignment E=2.3e-24

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 97% identity to pva:Pvag_pPag30292)

Predicted SEED Role

"Urea carboxylase-related ABC transporter, permease protein" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>IAI47_20170 ABC transporter permease (Pantoea sp. MT58)
MRHINRYPRQGMRLTLMLLPFILLIAVWFISSAVRLEANPQDKLLPGLSQMIAAIDRMAF
TPDKRSGEYLLWVDTWISLSRLLTGLAISSLIGLCIGIAAGVFPMTRAALSPFMTVVSMI
PPLALLPMLFIVFGLDELSKVMLIVIGITPMLARDLEHRAREIPAELFIKAQTLGANSWT
VVLRVVLPQLLSRLITSLRLLLGSAWLFLISAEAISATAGLGYRIFLVRRYMAMDVIIPY
VIWITLLAWLMDLALRQLHKACFPWAEGGRE