Protein Info for IAI47_20155 in Pantoea sp. MT58

Annotation: molybdate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13531: SBP_bac_11
  • amino acids 3 to 225 (223 residues), 120.7 bits, E=4.4e-39

Best Hits

Swiss-Prot: 45% identical to Y1146_PASMU: Uncharacterized protein PM1146 (PM1146) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 78% identity to pva:Pvag_pPag30297)

Predicted SEED Role

"Molybdenum-binding periplasmic protein"

Protein Sequence (228 amino acids)

>IAI47_20155 molybdate ABC transporter substrate-binding protein (Pantoea sp. MT58)
MRVLAAGSLKTVWPAMMAHFPHPVETHFGPAGLLRERIEAGERCDLFASASEEHPQRLLA
AGRALALMSFATNKLCLTVRSDCIQAGDDWYQLLTRDSLRIATSTPLADPSGDYAQVLFA
RMGPAGEAVRQRAQTVVGGRDSAAIPAGKLPAEWIIQSDQADLFIGYASYRKALSQIAGL
RVIDIPEAFNPVARYACAVITSEAGQLAAFLRLEPAKAVLREAGFGCD