Protein Info for IAI47_20105 in Pantoea sp. MT58

Annotation: ROK family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 PF13412: HTH_24" amino acids 15 to 58 (44 residues), 25.1 bits, see alignment 2.6e-09 PF12802: MarR_2" amino acids 19 to 68 (50 residues), 33 bits, see alignment 1.4e-11 PF00480: ROK" amino acids 86 to 374 (289 residues), 135.8 bits, see alignment E=5.9e-43

Best Hits

KEGG orthology group: None (inferred from 96% identity to pva:Pvag_pPag30310)

Predicted SEED Role

"Mlc, transcriptional repressor of MalT (the transcriptional activator of maltose regulon) and manXYZ operon" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>IAI47_20105 ROK family transcriptional regulator (Pantoea sp. MT58)
MKTSGTNLEHARAHNRRVVIEAIRLHGELTRAELARMTALTPQTVSNIVAELEQAELLTS
RQPRRSGRGQPSIPVTLNPTSAWSIGIHLDHQTLLLVLVDLSGEVHFRRLLMVQKPQPAA
TLACIASVLEEMRAFLGTQWQKVLGIGVVMPGPFGVEGISSTGPTTLNGWEQVDIEAELA
TISGLPVTLENDATVAAIGERFHGTARHLNSFIYLYIGTGLGAGIFTDGHIYTGHAQNAG
EIGHIVVEPGGRDCYCGNQGCLERYVSLQAAYEFCGLDPMRALPEDLLQIDPPRFTAWIE
SVMTPLRQAINILESVFDAEAVIIGGMMPAPLLEQMIKRLPPLYQSVRGRYLFDMRLKIG
MTGSDTAALGAAALPIFDEFNPQFQVLMK