Protein Info for IAI47_20055 in Pantoea sp. MT58

Annotation: non-canonical purine NTP pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 31% identical to IXTPA_THEAC: dITP/XTP pyrophosphatase (Ta0325) from Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)

KEGG orthology group: K01516, nucleoside-triphosphatase [EC: 3.6.1.15] (inferred from 98% identity to pva:Pvag_pPag30326)

Predicted SEED Role

"Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15)" in subsystem Heat shock dnaK gene cluster extended (EC 3.6.1.15)

MetaCyc Pathways

superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
UTP and CTP dephosphorylation I (5/7 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.15

Use Curated BLAST to search for 3.6.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (186 amino acids)

>IAI47_20055 non-canonical purine NTP pyrophosphatase (Pantoea sp. MT58)
MKIRFLSANEPKLAEVRKILEPIGVEVLPIARRIEEIQTENELDLVRDKLTKAFSLIGRP
LFVEHTGLYLDGLNGLPAGLTRIFWNRLDAERFTALVQGLDSQAVTAKTVLGYCDGRKMY
QFSGELRGTIAAKPAGTRGFQWDCVFIPEGYDQTFAEMGELKNEISMRRIALDRFATFLK
TSRGVA