Protein Info for IAI47_20045 in Pantoea sp. MT58

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF00005: ABC_tran" amino acids 31 to 189 (159 residues), 125.3 bits, see alignment E=4.2e-40 PF13304: AAA_21" amino acids 159 to 218 (60 residues), 33.7 bits, see alignment E=5.9e-12

Best Hits

Swiss-Prot: 52% identical to GLUA_COREF: Glutamate transport ATP-binding protein GluA (gluA) from Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)

KEGG orthology group: None (inferred from 97% identity to pva:Pvag_pPag30328)

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>IAI47_20045 amino acid ABC transporter ATP-binding protein (Pantoea sp. MT58)
MSEAIDYRTSHTTGAISITGVSKRFGKHKALDDVSLSLEPGSVTVILGPSGSGKSTLLRT
INHLERVDEGFIQIDGDYIGYQQRGNKLYELKEKAILRQRINVGYVFQNFNLFPHLSVLD
NLIEAPIAHRQLTKTEAIQRAGELLDIVGLRHKADAWPRHLSGGQQQRIAIARALMLNPR
VMLFDEPTSALDPELVGEVLDVIKKLARSGTTLVIVTHEIGFAREVADNVVFMVDGRIVE
QGSTTQVLNHPRHERTRRFLARVL