Protein Info for IAI47_19990 in Pantoea sp. MT58

Annotation: aspartate aminotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 PF00282: Pyridoxal_deC" amino acids 99 to 437 (339 residues), 206.6 bits, see alignment E=5.1e-65 PF05889: SepSecS" amino acids 212 to 351 (140 residues), 29.6 bits, see alignment E=3.1e-11

Best Hits

KEGG orthology group: K13745, L-2,4-diaminobutyrate decarboxylase [EC: 4.1.1.86] (inferred from 96% identity to pva:Pvag_pPag30339)

Predicted SEED Role

"Siderophore [Alcaligin-like] decarboxylase (EC 4.1.1.-) @ Siderophore biosynthesis L-2,4-diaminobutyrate decarboxylase" (EC 4.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-, 4.1.1.86

Use Curated BLAST to search for 4.1.1.- or 4.1.1.86

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (520 amino acids)

>IAI47_19990 aspartate aminotransferase family protein (Pantoea sp. MT58)
MLLRSSTQAALDLAPASNASGAETAIFNDQQLAAWSQQTQEVLTLMTRTVTGVEKPFSGI
LPHELAAEFSEVNLDHPLGNNEDALAELSQLYLRDAVWFHHPKYLAHLNCPVVLPSLMAE
QIMAAVNSSVDTWDQSAGGTLIEQKVIDWTLGRIGLPAGSDGIFTSGGTQSNLMAMLLAR
DSWCAAHHPGHLIKHRGLPETASKWRVFTSKLSHFSIQKSMAILGLGYDAVIAVDHDDHY
RMDAGCLAQEIARCRSEGLIPIAVVATSGTTDFGSIDPLPEIARLCDDYGLWMHVDAAYG
CGLLVSENHRSRLNGIERADSVTVDYHKSFFQTVSCGAFFVRDSQNLKHVTHHADYLNPL
SAQQEGTPNLVNKSIQTTRRFDALKMWLTLRVMGPAALGDAFDTLIDLTQAAHQLLTAHP
AIEVLHAPELTTQIFRYIPGKHASDAQIDEINAAIRKALFRSGNAVIAGTKVDGRQYLKF
TLLNPTTTIADLEDVLSLIAHYGREQVRASALSAANQGAI