Protein Info for IAI47_19910 in Pantoea sp. MT58

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 14 to 38 (25 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 153 to 178 (26 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 7 to 109 (103 residues), 71 bits, see alignment E=4.9e-24 PF00528: BPD_transp_1" amino acids 28 to 216 (189 residues), 59.1 bits, see alignment E=2.5e-20

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 98% identity to pva:Pvag_pPag30379)

Predicted SEED Role

"probable amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>IAI47_19910 amino acid ABC transporter permease (Pantoea sp. MT58)
MNLSSMIPELLSALPLTLGIMFVAMIVGFFLALIATFFRVRRIPVLSQLADLYVSYARSV
PVVLQLFVAFYGMPLITDNFGFNDFFTANVAAMIGLSLYHGGYLSEVMRPAYLAVERGQH
DATDSLGYSFRQKMLRVVGPQAVHFALPGYGNAIIYLIHNVALVMYIGAADVMATAHLIM
ERDYNQYQFGTYLVLAVLYSLLCGVAWLVIRFFEQRHAKYSSKSAARVKFTTSV