Protein Info for IAI47_19795 in Pantoea sp. MT58

Annotation: sugar porter family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 48 to 69 (22 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details amino acids 320 to 341 (22 residues), see Phobius details amino acids 348 to 371 (24 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details amino acids 418 to 436 (19 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 5 to 451 (447 residues), 299.9 bits, see alignment E=1.6e-93 PF00083: Sugar_tr" amino acids 13 to 453 (441 residues), 300.9 bits, see alignment E=1.8e-93 PF07690: MFS_1" amino acids 17 to 398 (382 residues), 101.5 bits, see alignment E=4.9e-33

Best Hits

KEGG orthology group: None (inferred from 72% identity to kva:Kvar_3232)

Predicted SEED Role

"Major myo-inositol transporter IolT" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>IAI47_19795 sugar porter family MFS transporter (Pantoea sp. MT58)
MRKHNLRLILFICAIASLSGVILGYDASVISGVIDPLTEHLNLTPWESGWAVSNVILGCI
GGAWSVGFISDRIGRKTTLIVTALLFLLSAVGAALAGSLTDFVIWRLTGGLAVGMASAIT
PLYIAEVSPKDWRGRMLGLQQMLMVGGQVTVYIVNYLIARGMPHQWIVSEGWRWMLASGV
VPCVLFLLLVPFMPESPRWLALNGKKERALEVLTRLSNARHAERLLQEILTSNRDDNIQT
RQRGILRDARARYILLVGCAIAILQQISGINILLYYAPSLLQNITGSTQSSLFHSIFIGL
ALLAGVAVCLSTIDRLGRTVLLRWGALGCALSMIFTALAFIADAGGLLPVIGLLAFVLIF
GLSWSLGAWLLISEIFPNRIRAVAMGFAFASMYVANFIVTQSFPMMNRSQVLMEHFHGAF
PLMLCAVGSLIAFWFVRRFLPETRGVSLEHIEPLMLSKSRRFAAEVKRSEQHPSSPAWAK
AK