Protein Info for IAI47_19665 in Pantoea sp. MT58

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 signal peptide" amino acids 1 to 53 (53 residues), see Phobius details transmembrane" amino acids 54 to 54 (1 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 124 to 141 (18 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details PF05230: MASE2" amino acids 21 to 109 (89 residues), 87.9 bits, see alignment E=3.8e-29 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 187 to 349 (163 residues), 149.5 bits, see alignment E=3.6e-48 PF00990: GGDEF" amino acids 192 to 346 (155 residues), 134.4 bits, see alignment E=3.3e-43

Best Hits

KEGG orthology group: None (inferred from 88% identity to pva:Pvag_pPag30424)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>IAI47_19665 diguanylate cyclase (Pantoea sp. MT58)
MNYYTPDDVQLKRRSTRFVRRMFMMRQLGTFLCFLPILSVLMEMGMCPQLCALLFTNAFV
WPYAAYRLALRSRDPTGFERKSLTLDAAFGGFWVANMALSPLPSIIIMAVLISDRYSAGG
WVQLKSAIKAFLFTFMLAWLVEKAPILLNFSTRTVWLTLPLASGYLLALSVVSHNLTLSL
RKKNRELERIALMDPGLKIPNRRLFEQRLESEFLRTQRGEGKAWLMLLDVDHFKQVNDTF
GHEAGDFLLAEISALLRNSVGLKDIPARFGGDELCVIVRDADEASITLLAEQIKQGIALL
RLPASPTFQCSVSIGIAPASDAESIHQWLRCADEALYQVKRAGRNNIQVWHSGTLETLDE
VRSR