Protein Info for IAI47_19470 in Pantoea sp. MT58

Annotation: GABA permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details amino acids 363 to 386 (24 residues), see Phobius details amino acids 402 to 423 (22 residues), see Phobius details amino acids 431 to 450 (20 residues), see Phobius details TIGR01773: GABA permease" amino acids 3 to 454 (452 residues), 703.7 bits, see alignment E=4.9e-216 PF03845: Spore_permease" amino acids 18 to 260 (243 residues), 29.7 bits, see alignment E=4.7e-11 PF00324: AA_permease" amino acids 20 to 428 (409 residues), 420.3 bits, see alignment E=1.5e-129 PF13520: AA_permease_2" amino acids 23 to 436 (414 residues), 154.4 bits, see alignment E=6.9e-49

Best Hits

Swiss-Prot: 65% identical to BAUD_PSEAE: Probable GABA permease (bauD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 96% identity to pva:Pvag_pPag30457)

MetaCyc: 64% identical to 4-aminobutanoate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-384; TRANS-RXN-57

Predicted SEED Role

"Aromatic amino acid transport protein AroP" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>IAI47_19470 GABA permease (Pantoea sp. MT58)
MTMTQNANEDSLAQNLKPRHVRMLSIAGVIGAGLFVGSGHAISEAGPAVLISYAAAGALV
VLIMRMLAEMAVASPDSGSFSTYADKALGRWAGFTIGWLYWWFWVLVIPLEANAAGTILH
AWFPDIAIWQFTFAITLLLTITNLLSVKNYGEFEFWFALIKVVAIILFLGVAGAAVFGLL
PDSNTSGLSHLYDTHGFMPNGIGAVVAAILTTMFSFMGTEIVTIAAAESKNPGKQITQAT
NSVIWRIALFYLLSIFFVVALVPWNTPGLVEQGSWQTALQAMNIPHARLIVDLVVLMAVC
SCLNSALYTSSRMLYSLSRRKDAPAAASRTNRSGTPWVAVLLSTAAAFLAVIANYLAPSA
VFEFLLATSGAIALLVYLVIAASHLVLRKKREKAGEVLSYRMWLFPGLTWVTILFIVTVL
IIMLCDPKHQSELLATGGLTLVIIATSLVLRRKKEVRQRTKYFTQRSSDPS