Protein Info for IAI47_19370 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 26 to 49 (24 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 91 to 107 (17 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 299 to 316 (18 residues), see Phobius details amino acids 322 to 345 (24 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details PF07690: MFS_1" amino acids 29 to 363 (335 residues), 121.4 bits, see alignment E=4.2e-39 amino acids 263 to 406 (144 residues), 41.1 bits, see alignment E=1.1e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>IAI47_19370 MFS transporter (Pantoea sp. MT58)
MTTRPAAEECTETGLFRTLKSFPATVHALLFFTLVIRFSYFMAWPFIAVIMTQNYHMSPI
AIGVAMTSSALFSVVLGMYGGQISDRLGRRVILLLGCGFSALGYSLLAQAAGMGLFIIGL
MTIGVSFAWVDPPLRALMSDLLVDRRRRALALQMRYYLINVAAVFGPLVGIAFGLTSQKG
TFLITGLTYIPFFIYVLLFIPAGKLVKEQDGDGVTVKLHQVIGIIARDNIYIAGLLCSIL
CSVVFIHYEAILPQYLLLLNSDAAIKLITLILVTNACTVLVFQTFIMRFLATVSLPKRIL
LGGFIFALSQICFFSTRSTEIWLWLTVTSVFSVGEAILMPNLNILLDQLAPPEHRGAYLG
ASMLSTLGIAVGPLIGGIMLAMTGAGVFICTALLSLLLCAIIYAYRNRMLARLKDA