Protein Info for IAI47_19345 in Pantoea sp. MT58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF07676: PD40" amino acids 92 to 105 (14 residues), 11.5 bits, see alignment (E = 5e-05) TIGR02276: 40-residue YVTN family beta-propeller repeat" amino acids 94 to 133 (40 residues), 34.7 bits, see alignment 6.5e-13 amino acids 309 to 348 (40 residues), 35.8 bits, see alignment 3e-13

Best Hits

KEGG orthology group: None (inferred from 73% identity to vpe:Varpa_4088)

Predicted SEED Role

"Surface antigen gene"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>IAI47_19345 hypothetical protein (Pantoea sp. MT58)
MTRPFVCSILAATVALASSFAWAGQAPYAASAADISVSHHDRVYAAEQFSNTVSVTDPAS
NTLLGVIKLGDAQPANLSPLYKGQVLVHGLGFSPDGKTLAVVSIGSNSVSLIDTATNAVK
HVTYVGRSPHEAFFTPDGKEIWVTVRGENYIAVLDGNSGEEKTRITVPGGPGMQIFSPDG
QYGYVCSSFNPETVVVDAKAHKIIGSIKQVSPFCPNIAATPDGRQVWFTLKDVGKVQVFD
ARPPFTLLKTIDSGPITNHVNIVHNAKGTFAYVTIGGLNKVNVYRTDDFRQVATIPVGNL
PHGVWPSGDGSRVYVGLENADALTAIDTLSNKVIATIPIGQAPQAVVYVPNAVPQGDGKQ
NLVPLGLAGKAAHLTLKEVNAAQGAQPATTLTLFDQGLTQVLQASATGLEPKQAYLLALS
SDAEGKGELEPLAQFMTNPAGAAIVNAVGPIRQVVNSHHADERRYLVIVKGTADQHGKPV
QIQVR