Protein Info for IAI47_19260 in Pantoea sp. MT58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 46 to 71 (26 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 255 to 289 (35 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 52 to 313 (262 residues), 115 bits, see alignment E=1.8e-37

Best Hits

Swiss-Prot: 40% identical to RBSC_BACSU: Ribose import permease protein RbsC (rbsC) from Bacillus subtilis (strain 168)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 57% identity to mcu:HMPREF0573_10531)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>IAI47_19260 ABC transporter permease (Pantoea sp. MT58)
MSSVTTPAKIKPPKQPLRVPAEAGIAVVFLLVMLGGFIATPNFLTVSNMMVLLLNGAVIG
FLCLGQSFVLLTGGIDLSCGSIVAMTCVVAALLMEKFGIPWPLAVPMVLAVGALSGLING
LIIERTGVPPFIVTFAMMGVAASIPQIITGAESIRVTQIGYSLIGQSKPLGIPFPVIALL
LAIVIGVIFLRRTITGTHIYAVGGNADAARLSGISIPRITLLVYAISGLCAACGGLIYGS
RLMTGYPTAGRGDELFFSIAGAVVGGVSLFGGTGSIIGAMIGAMLIAAISNLMNVLNVSA
YWQPLVIGLIILFGVTFDTLRTSKKIAIPWLKVRKPRKTQQ