Protein Info for IAI47_19245 in Pantoea sp. MT58

Annotation: SIS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01380: SIS
  • amino acids 33 to 135 (103 residues), 51 bits, E=6.6e-18

Best Hits

Swiss-Prot: 46% identical to PHI_BACSU: 3-hexulose-6-phosphate isomerase (hxlB) from Bacillus subtilis (strain 168)

KEGG orthology group: K08094, 6-phospho-3-hexuloisomerase [EC: 5.3.1.27] (inferred from 74% identity to ecl:EcolC_1650)

Predicted SEED Role

"6-phospho-3-hexuloisomerase" in subsystem Formaldehyde assimilation: Ribulose monophosphate pathway

MetaCyc Pathways

• formaldehyde assimilation II (assimilatory RuMP Cycle) (8/9 steps found)
• formaldehyde oxidation I (4/6 steps found)
• pentose phosphate pathway (oxidative branch) II (1/2 steps found)

KEGG Metabolic Maps

• Methane metabolism
• Pentose and glucuronate interconversions

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.27

Protein Sequence (186 amino acids)

>IAI47_19245 SIS domain-containing protein (Pantoea sp. MT58)
MGVQENTISILRELERNAQDIDNGQALQLIDRIRSANHIFLQGAGRSGIAIRAFANRLMH
LGLSVSVVGEISAPHSRPGDLLIIGSGSGETVSLRSLAQTATERGVEVALVTLKKESTIG
QLAGCVLVLPGTVKTGHANQAGQFSQPMGSAFEQLCFITYDAIVLELMKQMGETSETMFE
RHADFE