Protein Info for IAI47_19225 in Pantoea sp. MT58

Annotation: PTS sugar transporter subunit IIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02302: PTS_IIB
  • amino acids 3 to 61 (59 residues), 41.3 bits, E=1e-14

Best Hits

Swiss-Prot: 34% identical to SGCB_ECOLI: Putative phosphotransferase enzyme IIB component SgcB (sgcB) from Escherichia coli (strain K12)

KEGG orthology group: K02774, PTS system, galactitol-specific IIB component [EC: 2.7.1.69] (inferred from 88% identity to esc:Entcl_3471)

MetaCyc: 34% identical to putative PTS enzyme IIB component SgcB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PTS system, galactitol-specific IIB component (EC 2.7.1.69)" in subsystem D-Tagatose and Galactitol Utilization (EC 2.7.1.69)

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Protein Sequence (97 amino acids)

>IAI47_19225 PTS sugar transporter subunit IIB (Pantoea sp. MT58)
MINILVACGSGVATSTLAADEVKSVCAEYGISQYKINKCSMSELPSELQHADIVLTTNNY
KGEIGKPHMSVAGFITGINESTLRKKLGELLTELAGK