Protein Info for IAI47_19120 in Pantoea sp. MT58

Annotation: N-acetyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13420: Acetyltransf_4
  • amino acids 12 to 157 (146 residues), 47.2 bits, E=3.7e-16
• PF00583: Acetyltransf_1
  • amino acids 21 to 137 (117 residues), 56.3 bits, E=5.7e-19
• PF13508: Acetyltransf_7
  • amino acids 53 to 137 (85 residues), 35 bits, E=2.4e-12

Best Hits

Swiss-Prot: 55% identical to PAT_ALCFA: Phosphinothricin N-acetyltransferase (pat) from Alcaligenes faecalis

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 83% identity to eca:ECA0956)

Predicted SEED Role

"FIG01201438: hypothetical protein"

MetaCyc Pathways

• phosalacine biosynthesis (2/25 steps found)
• phosphinothricin tripeptide biosynthesis (2/25 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.183

Use Curated BLAST to search for 2.3.1.183

Protein Sequence (174 amino acids)

>IAI47_19120 N-acetyltransferase family protein (Pantoea sp. MT58)
MEITEADKRHIPAIQQIYAYHVLQGTATFETEPPDAAEIAARLEKVRSAGLPWFVAVEDG
QVRGYCYLSFYRERRAYRFTLEDSVYMDVNYQGRGTGKMLLSHAIAWAEARGFRQLVAVV
GNSENRGSLALHSAAGFSITGTLRSVGFKHGRWLDTVILQRTLGQGDATPAESN