Protein Info for IAI47_19070 in Pantoea sp. MT58

Annotation: metal ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 54 to 80 (27 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details PF00950: ABC-3" amino acids 8 to 263 (256 residues), 259.6 bits, see alignment E=1.7e-81

Best Hits

Swiss-Prot: 54% identical to YFED_YERPE: Chelated iron transport system membrane protein YfeD (yfeD) from Yersinia pestis

KEGG orthology group: K11606, manganese/iron transport system permease protein (inferred from 90% identity to pva:Pvag_pPag30483)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitD" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>IAI47_19070 metal ABC transporter permease (Pantoea sp. MT58)
MWILEPFQFAFMNSALLIALVVAIPCSLLSVFLVLKGWALMGDAMSHAVFPGIVLAWMVG
LPLGVGAFVAGLFCAVASGFLQDNSRIKQDTVLGIVFSGMFAVGLILYIAVKPEVHLDHI
LFGDMLGITGADIFQTFVIAAVIVMVIAVKWRDFMLFSFDPQQAQVSGLPARWLHYGLLC
MVSLTIVATLKAVGIILSISLLIAPGAIAVLLTRRFSHALLVAVVVSVLVSLSGVYLSFF
IDSAPAPTIVVLFALVFVVAMVVAGRKSRQLARLTFREGGRAG