Protein Info for IAI47_19065 in Pantoea sp. MT58

Annotation: iron/manganese ABC transporter permease subunit SitC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 56 to 81 (26 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 123 to 150 (28 residues), see Phobius details amino acids 174 to 191 (18 residues), see Phobius details amino acids 196 to 213 (18 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details PF00950: ABC-3" amino acids 10 to 264 (255 residues), 277.9 bits, see alignment E=8.6e-87 PF01032: FecCD" amino acids 64 to 244 (181 residues), 35 bits, see alignment E=8.5e-13

Best Hits

Swiss-Prot: 68% identical to YFEC_YERPE: Chelated iron transport system membrane protein YfeC (yfeC) from Yersinia pestis

KEGG orthology group: K11605, manganese/iron transport system permease protein (inferred from 96% identity to pva:Pvag_pPag30484)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitC" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>IAI47_19065 iron/manganese ABC transporter permease subunit SitC (Pantoea sp. MT58)
MELLLEPFGYHYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAYML
GLPFALGAFLSGGLAAGSMLLLNQRTRLKEDAIIGLIFSSFFGLGLFMVSLNPTAVNIQT
IVLGNILAIAPADILQLALIGGLSIIILLFKWKDLMVTFFDENHARAIGLRPERLKVLFF
TLLAVSTVAALQTVGAFLVICLVVTPGATAWLLTDRFPRLLMIAVAIGSITSFLGAWVSY
YLDGATGGIIVVAQTLLFLLAFVFAPKHGLLANRRRSCQQPDEEPG