Protein Info for IAI47_18810 in Pantoea sp. MT58

Annotation: NCS2 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 108 to 125 (18 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 287 to 309 (23 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details amino acids 348 to 366 (19 residues), see Phobius details amino acids 380 to 404 (25 residues), see Phobius details amino acids 416 to 434 (19 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 23 to 396 (374 residues), 142.6 bits, see alignment E=7.4e-46

Best Hits

Swiss-Prot: 82% identical to ADEP_ECOLI: Adenine permease AdeP (adeP) from Escherichia coli (strain K12)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 100% identity to pva:Pvag_3317)

MetaCyc: 82% identical to adenine:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-447

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>IAI47_18810 NCS2 family permease (Pantoea sp. MT58)
MSKQGVLQRIFRLQEHGTTVRTEVIAGITTFLTMVYIVFVNPQILGVAGMDTQAVFVTTC
LIAAFGSILMGLFANLPVALAPAMGLNAFFAFVVVGAMGYSWQVGMGAIFWGAVGLLILT
LLRVRYWMIANIPLSLRVGITAGIGLFIAMMGLKNAGIIVPNPDTLVAVGNLTSHSVLLG
ALGFFIIAILASRNIHAAVLISMVITTGIGWMLGDVKFVGLFSAPPSITSVVGQVDIKGA
FNIGMAGVIFSFMLVNLFDSSGTLIGVTDKAGLTDETGTFPRMQQALYVDSISSVSGALA
GTSSVTAYIESTSGVAIGGRTGLMAVVTGLLFLLVTFLSPLAAMVPSYAAAGALIYVGVL
MTASLSRVRWDDLTEAVPAFVTAAMMPFSFSITEGIALGFIAYCVMKLGTGRWREISPCV
VIVALLFVLKIVFVDGH