Protein Info for IAI47_18805 in Pantoea sp. MT58

Annotation: 6-phosphogluconate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00702: Hydrolase
  • amino acids 4 to 178 (175 residues), 90.5 bits, E=1.9e-29
• PF13419: HAD_2
  • amino acids 6 to 181 (176 residues), 82.3 bits, E=4.8e-27
• TIGR01509: HAD hydrolase, family IA, variant 3
  • amino acids 70 to 182 (113 residues), 45.1 bits, E=1.2e-15

Best Hits

Swiss-Prot: 59% identical to YIEH_ECOLI: 6-phosphogluconate phosphatase (yieH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to pva:Pvag_3318)

MetaCyc: 59% identical to 6-phosphogluconate phosphatase (Escherichia coli K-12 substr. MG1655)
3.1.3.-

Predicted SEED Role

"Putative phosphatase YieH" in subsystem 2-phosphoglycolate salvage

Protein Sequence (219 amino acids)

>IAI47_18805 6-phosphogluconate phosphatase (Pantoea sp. MT58)
MSVECVFFDCDGTLVDSELLCTQAYVNTFARYGLALSLQQMFEKYKGVKLYDIIRDVGDA
HQVTLPMEEVETAYRAEVARLFDLQLQPIPGAKALVEQIKVPMCVVSNGTVKKMQHSLGL
TGMLPLFEEHLYSGYDILHWKPDPELMYHAAEQMQVPIERCILVDDSEAGARAGIAAGIP
VYYYCADPHNPELDHPLVTRFDDMAQLPALWRARGWDLV