Protein Info for IAI47_18750 in Pantoea sp. MT58

Annotation: formate dehydrogenase accessory protein FdhE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 TIGR01562: formate dehydrogenase accessory protein FdhE" amino acids 2 to 305 (304 residues), 416.7 bits, see alignment E=3.4e-129 PF04216: FdhE" amino acids 22 to 304 (283 residues), 365.3 bits, see alignment E=1.7e-113

Best Hits

Swiss-Prot: 77% identical to FDHE_CROS8: Protein FdhE homolog (fdhE) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K02380, FdhE protein (inferred from 95% identity to pva:Pvag_3324)

Predicted SEED Role

"formate dehydrogenase formation protein FdhE" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>IAI47_18750 formate dehydrogenase accessory protein FdhE (Pantoea sp. MT58)
MSIRIIPQDPLEKGEKTTEEMIPPLLFPRLKNLYSRRAARLRDLAAKNPLGDYLRFAAVI
AEAQEIVLYDHPLHLDLHARLTQSASEGKPPLNIHTLPRDPHWQRLLHSLIAELKPEMSG
QALAVLENLEKASATELETLAGALFTGEYAQVSNDKAPFIWAALSLYWAQMAALIPGKAH
AEMGNQRQFCPVCASMPVASIVHMGSHESARYLHCNLCESEWHVVGSKCTQCEQSRDLHY
WSLSSEKAAVKAESCGDCGTYLKMLYQENDPAIEPVADDLASLILDAKMEQEGFARSSLN
PFMFPGE