Protein Info for IAI47_18740 in Pantoea sp. MT58

Annotation: formate dehydrogenase accessory sulfurtransferase FdhD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00129: formate dehydrogenase family accessory protein FdhD
  • amino acids 34 to 274 (241 residues), 289.4 bits, E=9.7e-91
• PF02634: FdhD-NarQ
  • amino acids 39 to 273 (235 residues), 228.6 bits, E=5e-72

Best Hits

Swiss-Prot: 75% identical to FDHD_ECOUT: Sulfur carrier protein FdhD (fdhD) from Escherichia coli (strain UTI89 / UPEC)

KEGG orthology group: K02379, FdhD protein (inferred from 96% identity to pva:Pvag_3328)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• formate oxidation to CO₂ (1/1 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Protein Sequence (274 amino acids)

>IAI47_18740 formate dehydrogenase accessory sulfurtransferase FdhD (Pantoea sp. MT58)
MKAIQPDSGEDLTIQTGVSRTQVWQRASLTDAQDDWLADEVPVALVYNDISHVVMMTTPK
DLEAFALGFSLSEGIIDAPGDIFGMDIVPGCHGIEVQIELSSRRFMALKEQRRALAGRTG
CGVCGVEQLDQIGKPLSPLPFTQTFALDHLDRALGQLKDYQPVGQKTGCTHAAAWIQPDG
QLAGGCEDVGRHVALDKLLGYRSQAAWGPGAVLVSSRASYEMVQKSAMCGVEILFAVSAA
TRLAVEVAERCNLTLVGFSKPGRATVYSHPQRLR