Protein Info for IAI47_18620 in Pantoea sp. MT58

Annotation: cellulose synthase operon protein YhjQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 TIGR03371: cellulose synthase operon protein YhjQ" amino acids 1 to 248 (248 residues), 196 bits, see alignment E=3.7e-62 PF06564: CBP_BcsQ" amino acids 1 to 244 (244 residues), 127.3 bits, see alignment E=2.4e-40 PF13614: AAA_31" amino acids 3 to 155 (153 residues), 51.4 bits, see alignment E=4.8e-17 PF01656: CbiA" amino acids 4 to 224 (221 residues), 68.8 bits, see alignment E=1.6e-22 PF09140: MipZ" amino acids 4 to 42 (39 residues), 22.1 bits, see alignment 3.1e-08 PF10609: ParA" amino acids 4 to 40 (37 residues), 34.9 bits, see alignment 4e-12 PF02374: ArsA_ATPase" amino acids 7 to 44 (38 residues), 24.6 bits, see alignment 5e-09

Best Hits

KEGG orthology group: None (inferred from 98% identity to pva:Pvag_3353)

Predicted SEED Role

"Cellulose synthase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>IAI47_18620 cellulose synthase operon protein YhjQ (Pantoea sp. MT58)
MPLVCVCSPKGGVGKTTLAANLAWSLARSGSKVLAIDFDVQNALRLHFGVPLHDGRGFVA
RSEEQADWSQSILTTGGNIFVLPYGDVTETQRERFEENLMKDPHFIKRGLDTVLNYPGLV
IVADFPPGPGPALKAMTALADMHLVVMLADTASVSLLPQIEENRMTGKPLNNKQGHYFIL
NQCDNRRNINRDVTAFMQQRLGDNLLGVVHRDESVGEANASQQSVYDFSPASAAAFDIEL
IAKRVSSILNITVGNGEVQAPIRTNHY