Protein Info for IAI47_18575 in Pantoea sp. MT58

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 80 to 97 (18 residues), see Phobius details amino acids 135 to 150 (16 residues), see Phobius details PF07859: Abhydrolase_3" amino acids 66 to 265 (200 residues), 43.3 bits, see alignment E=7.7e-15 PF20434: BD-FAE" amino acids 81 to 244 (164 residues), 52.5 bits, see alignment E=9.6e-18 PF00326: Peptidase_S9" amino acids 205 to 266 (62 residues), 36.5 bits, see alignment E=7.7e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to pva:Pvag_3370)

Predicted SEED Role

"Xylanase" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>IAI47_18575 alpha/beta hydrolase (Pantoea sp. MT58)
MHTEIINIWPHGDAPGASDSRAEPQIVDMAKEYEPYDRAATGVRCPEMAIWHPVESNGIT
LLVAPGGGYQRVMIDREGSALATFFTSMGYTLAVMTYRLPYDGHHEGPDAPLADAQRAVR
VLRERAQRGLNGKYIVMMGFSAGGHVAASLGTRFAEKLYPVQDGAENFSPRPDAMVLVYP
LISMRDGIAHEGARTRLLGAWPDQKTIEAYSMETRVHPLVPPTLLIHAADDDDVSVNHSM
AFFGALREHKVPAEVHFYQKGGHGFGIRGVADLPLASWPMLVTEWLRAKT