Protein Info for IAI47_18520 in Pantoea sp. MT58

Annotation: UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 43 to 61 (19 residues), see Phobius details amino acids 68 to 84 (17 residues), see Phobius details amino acids 96 to 120 (25 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 316 to 337 (22 residues), see Phobius details TIGR02380: undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphatetransferase" amino acids 3 to 345 (343 residues), 527.2 bits, see alignment E=9.4e-163 PF00953: Glycos_transf_4" amino acids 70 to 228 (159 residues), 105.7 bits, see alignment E=1.3e-34

Best Hits

Swiss-Prot: 78% identical to WECA_ECOL6: Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase (wecA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02851, undecaprenyl-phosphate alpha-N-acetylglucosaminyltransferase [EC: 2.7.8.-] (inferred from 98% identity to pva:Pvag_3383)

MetaCyc: 78% identical to UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase (Escherichia coli K-12 substr. MG1655)
GLCNACPTRANS-RXN [EC: 2.7.8.33]

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.- or 2.7.8.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>IAI47_18520 UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase (Pantoea sp. MT58)
MSTELGLIFLFSLAFLFFARKAAKKIGLVDKPNSRKRHHGAIPLVGGISVFAGICFTFAI
TNYYLPHAMLYLGCAGVLVLVGALDDRFDISVKFRAVVQAIVALVMMFGAKLYLLSLGFI
VGPFELIVGPFGYVLTLFAVWAAINAFNMVDGIDGLLGGLSSVTFAAMGIILYFDGQTSL
AMWCFAMIAATLPYILLNLGFLGRRFKVFMGDAGSTMIGFTIIWILLETTQGLSHPITPV
TALWLIAIPLMDMVAIMYRRLRKGMSPFSADRQHIHHLIMRAGFTSRQAFVLITVAAAIL
AGIGVLGEYLAFIPEWVMLLLFLGAFMVYGYCLKHAWRVARRIRRIKRRLSHYREAKNK