Protein Info for IAI47_18490 in Pantoea sp. MT58

Annotation: dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 TIGR02382: TDP-D-fucosamine acetyltransferase" amino acids 43 to 229 (187 residues), 257.4 bits, see alignment E=3.5e-81 PF13302: Acetyltransf_3" amino acids 102 to 218 (117 residues), 28.1 bits, see alignment E=7.3e-10 PF13673: Acetyltransf_10" amino acids 111 to 217 (107 residues), 29.3 bits, see alignment E=1.9e-10 PF00583: Acetyltransf_1" amino acids 121 to 217 (97 residues), 51.4 bits, see alignment E=3.2e-17 PF13508: Acetyltransf_7" amino acids 137 to 217 (81 residues), 41.4 bits, see alignment E=3.8e-14

Best Hits

Swiss-Prot: 55% identical to WECD_ECOL6: dTDP-fucosamine acetyltransferase (wecD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 93% identity to pva:Pvag_3388)

MetaCyc: 54% identical to RffC (Escherichia coli K-12 substr. MG1655)
TDPFUCACTRANS-RXN [EC: 2.3.1.210]

Predicted SEED Role

"Lipopolysaccharide biosynthesis protein RffC"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.210

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>IAI47_18490 dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase (Pantoea sp. MT58)
MPVHVNINPLSWESTFFGVDTVRLEPQGETPLEQALRHPCALIQMKVAASETALIDTLQQ
HQFQLAEGEADLTLAVKETERQAGIRIARDAQIPPLRDAASQLFSQSRFRAPWYAPDASG
RFYAQWIENAVRGTFDDQCLVASDATGQLQGFVSLRVADGDARIGLLGVLPDAQGQGVGQ
RLLLAAADWARVRQLAQLRVATQMSNLTAMRLYLRSGARLDSTAYWFYRKGHDSI