Protein Info for IAI47_18480 in Pantoea sp. MT58

Annotation: lipid III flippase WzxE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 80 to 107 (28 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 362 to 382 (21 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details PF01943: Polysacc_synt" amino acids 5 to 283 (279 residues), 38.9 bits, see alignment E=6.9e-14 PF13440: Polysacc_synt_3" amino acids 83 to 329 (247 residues), 32.4 bits, see alignment E=6.2e-12

Best Hits

Swiss-Prot: 69% identical to WZXE_SHIFL: Lipid III flippase (wzxE) from Shigella flexneri

KEGG orthology group: K03328, polysaccharide transporter, PST family (inferred from 98% identity to pva:Pvag_3390)

MetaCyc: 69% identical to lipid IIIECA flippase (Escherichia coli K-12 substr. MG1655)
7.5.99.a [EC: 7.5.99.a]

Predicted SEED Role

"WzxE protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.99.a

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>IAI47_18480 lipid III flippase WzxE (Pantoea sp. MT58)
MSLARASVWTASSTLVKIVAGLLVVKLLAVSFGPEGVGQAGNFRQLITVLGVLAGAGIFN
GVTTYVAQYQQQPGQLRAMVGTASAMVLGFSGVLALLFLLAAAPISAALFGHDRYQGVIR
VVAFLQLGIAWANFTLALLKGYRDARGNALALILGSLTGVAGYLLCWWLGGYQGALIGLA
LVPALLLLPALLMLKRRAPLPLSWLRPQWHPELARNLAKYTLMALITAVTLPVAWVLMRN
LLAEQEGWAQVGLWQGVTSISDAYLQFITATFSVWLLPTLARLESKHDIAREIGRALRFV
LPAVAVASFGVWVLRDFAISLLFSEAFRGMRDLFVWQLCGDVFKVGAYVFGYLVIAKASL
RFYVLTEISQFLLLTLFSRWLIPLHGATGAAQAYMFTYVAYFALCCGAFIVYCRKK