Protein Info for IAI47_18465 in Pantoea sp. MT58

Annotation: lipopolysaccharide N-acetylmannosaminouronosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR00696: glycosyltransferase, WecB/TagA/CpsF family" amino acids 61 to 237 (177 residues), 228.7 bits, see alignment E=2e-72 PF03808: Glyco_tran_WecG" amino acids 65 to 231 (167 residues), 179.6 bits, see alignment E=2.3e-57

Best Hits

Swiss-Prot: 70% identical to WECG_PECCP: UDP-N-acetyl-D-mannosaminuronic acid transferase (wecG) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K02852, UDP-N-acetyl-D-mannosaminuronic acid transferase [EC: 2.4.1.-] (inferred from 80% identity to pam:PANA_0158)

MetaCyc: 64% identical to UDP-N-acetyl-D-mannosaminuronic acid transferase (Escherichia coli K-12 substr. MG1655)
Lipopolysaccharide N-acetylmannosaminouronosyltransferase. [EC: 2.4.1.180]

Predicted SEED Role

"Probable UDP-N-acetyl-D-mannosaminuronic acid transferase (EC 2.4.1.-)" (EC 2.4.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.- or 2.4.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>IAI47_18465 lipopolysaccharide N-acetylmannosaminouronosyltransferase (Pantoea sp. MT58)
MTTLTETPQYRIRGVDLYGFENMPSAVNFLMPPQRVRSGILVAINAEKILTAERDEGLRT
LLAQAEYAYADGISIVRSIRKKYPQASVQRIAGADLWEALMERAGREGTPVFLIGGRQRV
LDETCDKLRRQWNVNIVGAQDGYFAPADQDALFARIAASGAKLVTVALGSPRQELLMLAC
RAHCPDALYMGVGGTYDVFTGHVKRAPKIWQRLGLEWLYRLIRQPSRLRRQLKLLKYLRY
HWRGDL