Protein Info for IAI47_18435 in Pantoea sp. MT58

Annotation: uroporphyrinogen-III C-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 66% identical to HEMX_ECOLI: Protein HemX (hemX) from Escherichia coli (strain K12)

KEGG orthology group: K02496, uroporphyrin-III C-methyltransferase [EC: 2.1.1.107] (inferred from 98% identity to pva:Pvag_3399)

Predicted SEED Role

"Homolog of E. coli HemX protein"

MetaCyc Pathways

siroheme biosynthesis (4/4 steps found)
factor 430 biosynthesis (3/7 steps found)
cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (2/13 steps found)
cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (3/15 steps found)
adenosylcobalamin biosynthesis II (aerobic) (13/33 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (12/36 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.107

Use Curated BLAST to search for 2.1.1.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>IAI47_18435 uroporphyrinogen-III C-methyltransferase (Pantoea sp. MT58)
MTEQKDSSAMVEETTPAVDRSSSSNSIPPRNAKKGGMVLGAVAIVIALAMGAGLYLNGKH
QADLQAQTNQKLSDQLSALQQQAGSDKQQLTQQLSSAEKALQTAQQQQNASAKELETLRE
KVAVISGNDVRSWLLAQADYLVKLAGRKLWSDQDVTTAAALLKSADASLADMNDPSVMNV
RRALTQDISNLSSVTQVDYDGVILKLNQLSNNVDNLRLADNDSDDAPMDSDGGELSGSVR
EWRQNLVKSWHNFMDDFITIRRRDNTAQPLLAPNQDVYLRENIRSRLLIAAQAVPRHQDE
IYKQSIDTVSAWVRAWYDTNDAATKAFLAQLDELSQQNINMDLPDNLESQPLLEQLMQTR
VRNLLAQPSAAANQQGG